missing translation for 'onlineSavingsMsg'
Learn More

FLJ10803 Recombinant Protein, Abnova

Brand:  Abnova H00055744-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16131753

  • 3343.96 SEK / 10µg

Estimated Shipment: 03-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH56884
Solution
55744
FLJ10803 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C7orf44
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
41.8
8
Glutathione Sepharose 4 Fast Flow
10 ug
MMWQKYAGSRRSMPLGARILFHGVFYAGGFAIVYYLIQKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSKGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE
FLJ10803
C7orf44
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates