missing translation for 'onlineSavingsMsg'
Learn More

FLJ20457 Recombinant Protein, Abnova

Brand:  Abnova H00054942-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16120953

  • 5740.00 SEK / 25µg
Estimated Shipment: 19-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH15795
Solution
54942
FLJ20457 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C9orf6
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
45.65
8
Glutathione Sepharose 4 Fast Flow
25 ug
MATEPEAAEPVVPSLVDRYFTRWYKPDVKGKFCEDHCILQHSNRICVITLAESHPVLQSGKTIKSISYQISTNCSRLQNKVSGKFKRGAQFLTELAPLCKIYCSDGEEYTVSSCVRGRLMEVNENILHKPSILQEKPSTEGYIAVVLPKFEESKSITEGLLTQKQYEEVMVKRINATTATS
CG-8/FLJ20457
C9orf6
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers