missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ FLT3 (Human) Recombinant Protein
Human FLT3 partial ORF ( NP_004110, 91 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.
4515.00 SEK - 6845.00 SEK
Specifications
| Accession Number | NP_004110 |
|---|---|
| Gene ID (Entrez) | 2322 |
| Name | fms-related tyrosine kinase 3 |
| Preparation Method | Wheat germ expression system |
| Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16108254
|
Abnova™
H00002322-Q01.10UG |
10 μg |
4515.00 SEK
10µg |
Estimated Shipment: 29-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16118254
|
Abnova™
H00002322-Q01.25UG |
25 μg |
6845.00 SEK
25µg |
Estimated Shipment: 29-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
- Sequence: LQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVP
Specifications
| NP_004110 | |
| fms-related tyrosine kinase 3 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| CD135, FLK2, STK1 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 2322 | |
| Wheat germ expression system | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLT3 | |
| GST |