missing translation for 'onlineSavingsMsg'
Learn More

Print

FOLH1B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

4369.22 SEK

Specifications

Antigen	FOLH1B
Dilution	Western Blot 1.0 ug/ml
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 1

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18332275 View Documents Promotion Details missing translation for 'viewProductCertificates'	Bio-Techne NBP3-09721-100UL	100 μg	4369.22 SEK 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

Description

FOLH1B Polyclonal specifically detects FOLH1B in Human samples. It is validated for Western Blot.

Specifications

Specifications

Antigen	FOLH1B
Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human
Gene ID (Entrez)	219595
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Dilution	Western Blot 1.0 ug/ml
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Formulation	PBS buffer, 2% sucrose
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of Human FOLH1B (NP_710163). Peptide sequence ELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLG
Purification Method	Affinity purified

Back to Top