missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FOS Recombinant Protein

4515.00 SEK - 6845.00 SEK

Accession Number	AAH04490
For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez)	2353
Molecular Weight (g/mol)	67.54

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16175111 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00002353-P01.10UG	10 ug	4515.00 SEK 10µg View alternative products missing translation for 'toSaveUpto' »	Estimated Shipment: 13-06-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

16185111 missing translation for 'viewDocuments' Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00002353-P01.25UG	25 ug	6845.00 SEK 25µg View alternative products missing translation for 'toSaveUpto' »	Estimated Shipment: 13-06-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH04490
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	67.54
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	FOS
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	2353
Name	FOS (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Gene Alias	AP-1/C-FOS
Gene Symbol	FOS
Species	Wheat Germ (in vitro)
Protein Tag	GST

Description