missing translation for 'onlineSavingsMsg'
Learn More

Frequenin Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-10322-100UL

Product Code. 18323204

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Frequenin Polyclonal specifically detects Frequenin in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

Antigen	Frequenin
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml, Immunohistochemistry
Gene Alias	DKFZp761L1223, FREQFLUP, frequenin (Drosophila) homolog, Frequenin homolog, frequenin homolog (Drosophila), Frequenin-like protein, Frequenin-like ubiquitous protein, NCS-1, neuronal calcium sensor 1
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human Frequenin (NP_055101). Peptide sequence MGKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQK
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot, Immunohistochemistry
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	23413
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description