missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
FXR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
2925.00 SEK - 5235.00 SEK
Specifikationer
| Antigen | FXR1 |
|---|---|
| Användningsområden | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Värd art | Rabbit |
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|
18473631
|
Novus Biologicals
NBP1-89546-25ul |
25 μL |
2925.00 SEK
25µL |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
|
18727333
|
Novus Biologicals
NBP1-89546 |
0.1 mL |
5235.00 SEK
0.10ml |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
Beskrivning
FXR1 Polyclonal specifically detects FXR1 in Human, Mouse, Rat samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifikationer
| FXR1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Immune System Diseases, Immunology | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 8087 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| fragile X mental retardation syndrome-related protein 1, fragile X mental retardation, autosomal homolog 1, FXR1P, hFXR1p | |
| FXR1 | |
| IgG | |
| Affinity Purified | |
| Specificity of FXR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel