missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FXR1 (Human) Recombinant Protein

Human FXR1 partial ORF ( AAH28983, 121 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00008087-Q01.25ug

Product Code. 16138215

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Sequence: VKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFH

Specifications

Accession Number	AAH28983
Name	fragile X mental retardation, autosomal homolog 1
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Gene ID (Entrez)	8087
Preparation Method	Wheat germ expression system
Quantity	25 μg
Gene Symbol	FXR1
Protein Tag	GST

Product Suggestions

Description