missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GABA-A R gamma 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
3675.00 SEK - 5775.00 SEK
Specifications
Antigen | GABA-A R gamma 1 |
---|---|
Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
Applications | Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
18323553
|
Bio-Techne
NBP3-17492-25UL |
25 μg |
3675.00 SEK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
18305312
|
Bio-Techne
NBP3-17492-100UL |
100 μg |
5775.00 SEK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GABA-A R gamma 1 Polyclonal antibody specifically detects GABA-A R gamma 1 in Human samples. It is validated for ImmunofluorescenceSpecifications
GABA-A R gamma 1 | |
Immunofluorescence | |
Unconjugated | |
Rabbit | |
Stem Cell Markers | |
PBS, pH 7.2, 40% glycerol | |
2565 | |
IgG | |
Affinity purified |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
Polyclonal | |
Purified | |
RUO | |
Human | |
DKFZp686H2042, GABA(A) receptor subunit gamma-1, gamma-1 polypeptide, gamma-aminobutyric acid (GABA) A receptor, gamma 1, gamma-aminobutyric acid receptor subunit gamma-1, MGC33838 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: NKASMTPGLHPGSTLIPMNNISVPQEDDYGYQCLEGKDC | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |