missing translation for 'onlineSavingsMsg'
Learn More

GCFC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-09963-100UL

Product Code. 18323264

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

GCFC2 Polyclonal specifically detects GCFC2 in Human samples. It is validated for Western Blot.

Specifications

Antigen	GCFC2
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	C2orf3, chromosome 2 open reading frame 3, DNABF, GC bindng factor, GCF, GCFGC binding factor, GC-rich sequence DNA-binding factor, GC-rich sequence DNA-binding factor 2, TCF9, TCF-9, Transcription factor 9, transcription factor 9 (binds GC-rich sequences)
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human TCF9 (NP_003194). Peptide sequence QKQKKVFEEVQDDFCNIQNILLKFQQWREKFPDSYYEAFISLCIPKLLNP
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	6936
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description