missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
GLT8D2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
4665.00 SEK - 7005.00 SEK
Specifikationer
| Antigen | GLT8D2 |
|---|---|
| Utspädning | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Användningsområden | Immunofluorescence |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|
18305586
|
Novus Biologicals
NBP3-17856-25UL |
25 μg |
4665.00 SEK
25µL |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
|
18324085
|
Novus Biologicals
NBP3-17856-100UL |
100 μg |
7005.00 SEK
100µL |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
Beskrivning
GLT8D2 Polyclonal antibody specifically detects GLT8D2 in Human samples. It is validated for ImmunofluorescenceSpecifikationer
| GLT8D2 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| EC 2.4.1, EC 2.4.1.-, FLJ31494, GALA4A, glycosyltransferase 8 domain containing 2, glycosyltransferase 8 domain-containing protein 2, gycosyltransferase | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: TRIRKWIEHSKLREINFKIVEFNPMVLKGKIRPDSSRPELLQPLNFVRFYLPLLIHQHEKVIYLDD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 83468 | |
| IgG | |
| Affinity purified |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel