missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Novus Biologicals™ glutamine rich 2 Recombinant Protein Antigen
Handla allt Bio Techne Produkter
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Beskrivning
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human glutamine rich 2. Source: E.coli Amino Acid Sequence: TAHPSDGVSSREQSKVPSGTGRQQQPRARDEAGVPRLHQSSTFQFKSDSDRHRSREKLTSTQPRRNARPGPVQQDLPLARDQPSSVPASQSQVHLR The glutamine rich 2 Recombinant Protein Antigen is derived from E. coli. The glutamine rich 2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifikationer
Specifikationer
| Gen-ID (Entrez) | 84074 |
| Reningsmetod | >80% by SDS-PAGE and Coomassie blue staining |
| Vanligt namn | glutamine rich 2 Recombinant Protein Antigen |
| Innehåll och lagring | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulering | PBS and 1M Urea, pH 7.4. |
| För användning med (applikation) | Blocking/Neutralizing, Control |
| Gene Alias | glutamine rich 2, glutamine-rich protein 2 |
| Gensymbol | QRICH2 |
| Etiketttyp | Unlabeled |
| Produkttyp | Recombinant Protein Antigen |
| Visa mer |
For Research Use Only.
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering