missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Biokemiska reagenser
  4. Peptider
  5. 18256949

Novus Biologicals™ Glutamine Synthetase Recombinant Protein Antigen

Produktkod. 18256949 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
0,1 ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18256949 0,1 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18256949 Leverantör Novus Biologicals™ Leverantörsnummer NBP189768PEP
 Begränsad artikel
Beräknad leverans: 14-10-2026
Lägg i varukorgen
Lägg i varukorgen
Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLUL. The Glutamine Synthetase Recombinant Protein Antigen is derived from E. coli. The Glutamine Synthetase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-89768. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifikationer

Gen-ID (Entrez) 2752
Art Human
Reningsmetod Chromatography
Renhet >80%
Koncentration 0.5mg/mL
Innehåll och lagring Store at -20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
För användning med (applikation) Blocking/Neutralizing, Control
Gensymbol GLUL
Etiketttyp Unlabeled
Molekylvikt (g/mol) 34kDa
Produkttyp Glutamine Synthetase
Kvantitet 0,1 ml
Regulatorisk status RUO
Källa E.Coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89768. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen LQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGP
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.