missing translation for 'onlineSavingsMsg'
Learn More

Glypican 4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-17858-100UL

Product Code. 18337254

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Glypican 4 Polyclonal antibody specifically detects Glypican 4 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	Glypican 4
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias	glypican 4, glypican proteoglycan 4, glypican-4, K-glypicandJ900E8.1 (glypican 4)
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: LVTDVKEKLKQAKKFWSSLPSNVCNDERMAAGNGNEDDCWNGKGKSRYLFAVTGNGLANQGNNPEVQVDTSKPDILILRQIMAL
Quantity	100 μg
Research Discipline	Cancer, Stem Cells
Gene ID (Entrez)	2239
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Description