missing translation for 'onlineSavingsMsg'
Learn More

GPR45 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-09566-100UL

Product Code. 18322645

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

GPR45 Polyclonal specifically detects GPR45 in Human samples. It is validated for Western Blot.

Specifications

Antigen	GPR45
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	G protein-coupled receptor 45, high-affinity lysophosphatidic acid receptor, probable G-protein coupled receptor 45, PSP24, PSP24(ALPHA), PSP24-1, PSP24A, PSP24-alpha
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPR45 (NP_009158). Peptide sequence LNTSNASDSGSTQLPAPLRISLAIVMLLMTVVGFLGNTVVCIIVYQRPAM
Quantity	100 μg
Research Discipline	GPCR
Gene ID (Entrez)	11250
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description