missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Biokemiska reagenser
  4. Peptider
  5. 18374450

Novus Biologicals™ GPT Recombinant Protein Antigen

Codice prodotto. 18374450 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Kvantitet:
0,1 ml
Dimensione della confezione:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Kvantitet unitSize
18374450 0,1 ml 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18374450 Fornitore Novus Biologicals™ N. del fornitore NBP189111PEP
 Begränsad artikel
Beräknad leverans: 14-10-2026
Aggiungi al carrello
Aggiungi al carrello
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPT. The GPT Recombinant Protein Antigen is derived from E. coli. The GPT Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-89111. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifica

Gen-ID (Entrez) 2875
Art Human
Reningsmetod Chromatography
Renhet >80%
Koncentration 0.5mg/mL
Innehåll och lagring Store at -20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
För användning med (applikation) Blocking/Neutralizing, Control
Gene Alias AAT1alanine aminotransferase 1, ALT1, ALT1EC 2.6.1.2, Glutamate pyruvate transaminase 1, glutamic-alanine transaminase 1, Glutamic--alanine transaminase 1, glutamic-pyruvate transaminase (alanine aminotransferase), Glutamic--pyruvic transaminase 1, GPT1GPT 1
Gensymbol GPT
Etiketttyp Unlabeled
Molekylvikt (g/mol) 24kDa
Produkttyp GPT
Kvantitet 0,1 ml
Regulatorisk status RUO
Forskningskategori metabolism
Källa E.Coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89111. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen MASSTGDRSQAVRNGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFT
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.