missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ GSTA4 (Human) Recombinant Protein

Name: Abnova&trade; GSTA4 (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16125831
Price: 4515.00 EUR

Human GSTA4 full-length ORF ( AAH15523, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00002941-P01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16125831

Estimated Shipment: 28-06-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Descripción

Sequence: MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

Especificaciones

Accession Number	AAH15523
Name	glutathione S-transferase alpha 4
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	GSTA4
Protein Tag	GST

Gene ID (Entrez)	2941
Preparation Method	Wheat germ expression system
Quantity	10 μg
Gene Alias	DKFZp686D21185, GSTA4-4, GTA4
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Sugerencias de productos

Descripción