missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. GTP binding protein era homolog Antibody, Novus Biologicals™

GTP binding protein era homolog Antibody, Novus Biologicals™

Código de producto. 18444001 Tienda Bio Techne Productos
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Kvantitet:
25 μL
0.1 mL
missing translation for 'unitSize':
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Kvantitet missing translation for 'unitSize'
18444001 25 μL -
18255966 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 missing translation for 'options'
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18444001 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP18970325ul
  • ONLINE EXCLUSIVE PRICE
    4441.54 SEK
    3748.50 SEK / 25µL
    Save 693.04 SEK
    15% Av
 Begränsad artikel
Beräknad leverans: 01-12-2026
Añadir a la cesta
Añadir a la cesta

missing translation for 'validMainframeMsg'

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

GTP binding protein era homolog Polyclonal specifically detects GTP binding protein era homolog in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen GTP binding protein era homolog
Användningsområden Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
Formulering PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias CEGA, Conserved ERA-like GTPase, ERA, Era (E. coli G-protein homolog)-like 1, Era G-protein-like 1 (E. coli), ERAL1A, ERA-like protein 1, ERA-W, GTPase Era, mitochondrial, GTPase, human homolog of E. coli essential cell cycle protein Era, GTP-binding protein era homolog, HERA, H-ERA, HERA-A, HERA-B
Gensymboler ERAL1
Värd art Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SVLVMNKVDCLKQKSVLLELTAALTEGVVNGKKLKMRQAFHSHPGTHCPSPAVKDPNTQSVGNPQRIGWPHFKEIFMLSALSQEDVKTLKQY
Reningsmetod Affinity Purified
Kvantitet 25 μL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 26284
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Innehåll och lagring Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Isotyp IgG
Produktlinje Novus
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.