missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Biokemiska reagenser
  4. Peptider
  5. 18258101

R&D Systems™ HINT2 Recombinant Protein Antigen

Produktkod. 18258101 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μl
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18258101 100 μl
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Product Code. 18258101 Supplier R&D Systems™ Supplier No. NBP256156PEP
 Begränsad artikel
Beräknad leverans: 20-01-2027
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HINT2. Source: E.coli Amino Acid Sequence: GVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQ The HINT2 Recombinant Protein Antigen is derived from E. coli. The HINT2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifications

Gen-ID (Entrez) 84681
Produktlinje Novus
Reningsmetod >80% by SDS-PAGE and Coomassie blue staining
Vanligt namn HINT2 Recombinant Protein Antigen
Innehåll och lagring Store at −20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
För användning med (applikation) Blocking/Neutralizing, Control
Gene Alias EC 3.-, HINT-2, HINT-3, histidine triad nucleotide binding protein 2, histidine triad nucleotide-binding protein 2, mitochondrial, HIT-17, HIT-17kDa, PKCI-1-related HIT protein, protein kinase C inhibitor-2
Gensymbol HINT2
Etiketttyp Unlabeled
Produkttyp Recombinant Protein Antigen
Kvantitet 100 μl
Regulatorisk status RUO
Forskningskategori Signal Transduction
Källa E.Coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50415. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Show More Show Less

For Research Use Only.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.