missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ HIST1H2BN Recombinant Protein

Name: Abnova&trade; HIST1H2BN Recombinant Protein
Brand: Abnova&trade;
SKU: 16132382
Price: 6845.00 EUR

Brand: Abnova™ H00008341-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16132382

Estimated Shipment: 29-05-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH11372
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	44
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 ug
Immunogen	MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKKRKRRFTESIKKAHGFRKLKIWLKLRVSNQSPDDIYIARD
Gene Alias	H2B/d/H2BFD/HIST1H3I/MGC125414/MGC125415/MGC125416/MGC9388
Gene Symbol	HIST1H2BN
Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	8341
Name	HIST1H2BN (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	HIST1H2BN
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

Product Suggestions

Description