missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 18731923

HIV-1 Gag p24 Antibody, Alexa Fluor™ 750, Novus Biologicals™

Produktkod. 18731923 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18731923 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18731923 Leverantör Novus Biologicals Leverantörsnummer NBP241214AF750

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

HIV-1 Gag p24 Polyclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen HIV-1 Gag p24
Användningsområden Western Blot, ELISA
Klassificering Polyclonal
Konjugera Alexa Fluor 750
Formulering 50mM Sodium Borate
Värd art Rabbit
Immunogen Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein . Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla
Reningsmetod Peptide affinity purified
Kvantitet 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Infections (Virus Bacteria and Parasites)
Primär eller sekundär Primary
Gen-ID (Entrez) 155030
Målarter Virus
Innehåll och lagring Store at 4°C in the dark.
Form Purified
Isotyp IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.