missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ HRAS (Human) Recombinant Protein

Human HRAS full-length ORF ( NP_005334, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00003265-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16119604

  • 3860.70 SEK / 10µg
Estimated Shipment: 12-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS
Specifications

Specifications

NP_005334
v-Ha-ras Harvey rat sarcoma viral oncogene homolog
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HRAS
GST
3265
Wheat germ expression system
10 μg
C-BAS/HAS, C-H-RAS, C-HA-RAS1, CTLO, H-RASIDX, HAMSV, HRAS1, K-RAS, N-RAS, RASH1
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers