missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AADAT Full-length ORF (AAH31068.1, 1 a.a. - 429 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00051166-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16179722

  • 5030.41 SEK / 25µg

Estimated Shipment: 23-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Two alternative transcripts encoding the same isoform have been identified, however, additional alternative transcripts and isoforms may exist. [provided by RefSeq]

Sequence: MNYARFITAASAARNPSPIRTMSEKRADILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYQPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL
Specifications

Specifications

AAH31068.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
74.3kDa
Glutathione Sepharose 4 Fast Flow
25 ug
RUO
AADAT
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
51166
AADAT (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KAT2/KATII
AADAT
Yes
Videos
SDS
Documents
Certificates