missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AATF Partial ORF (AAH00591, 151 a.a. - 250 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00026574-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16178372

  • 3343.96 SEK / 10µg

Estimated Shipment: 11-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis. [provided by RefSeq]

Sequence: VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT
Specifications

Specifications

AAH00591
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT
RUO
AATF
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
26574
AATF (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CHE-1/CHE1/DED
AATF
Yes
Videos
SDS
Documents
Certificates