missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ABI1 Partial ORF (NP_001012770, 185 a.a. - 238 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010006-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16161616

  • 6150.00 SEK / 25µg
Estimated Shipment: 27-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene has been found to form a complex with EPS8 and SOS1, and is thought to be involved in the transduction of signals from Ras to Rac. In addition, the encoded protein may play a role in the regulation of EGF-induced Erk pathway activation as well as cytoskeletal reorganization and EGFR signaling. Several transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq]

Sequence: GTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHSGSS
Specifications

Specifications

NP_001012770
Liquid
10006
ABI1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ABI-1/E3B1/NAP1BP/SSH3BP/SSH3BP1
ABI1
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.68kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHSGSS
RUO
ABI1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers