missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ACBD3 Partial ORF (NP_073572, 73 a.a. - 171 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00064746-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16179696

  • 5030.41 SEK / 25µg

Estimated Shipment: 23-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq]

Sequence: RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
Specifications

Specifications

NP_073572
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
RUO
ACBD3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
64746
ACBD3 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GCP60/GOCAP1/GOLPH1/PAP7
ACBD3
Yes
Videos
SDS
Documents
Certificates