Learn More
Abnova™ Human ACVR1C Partial ORF (AAH22530.1, 23 a.a. - 112 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00130399-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]).[supplied by OMIM]
Sequence: SPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMSpecifications
AAH22530.1 | |
Liquid | |
130399 | |
ACVR1C (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ACVRLK7/ALK7 | |
ACVR1C | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.53kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
SPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPM | |
RUO | |
ACVR1C | |
Wheat Germ (in vitro) | |
GST |