missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ADAM33 Partial ORF (NP_079496, 551 a.a. - 650 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00080332-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16130277

  • 5030.41 SEK / 25µg

Estimated Shipment: 23-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq]

Sequence: AHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVTCRGALALPSAQLDLLGLGLVEPGTQCGPRMVCQSRRCRKNAFQEL
Specifications

Specifications

NP_079496
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVTCRGALALPSAQLDLLGLGLVEPGTQCGPRMVCQSRRCRKNAFQEL
RUO
ADAM33
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
80332
ADAM33 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C20orf153/DJ964F7.1/DKFZp434K0521/FLJ35308/FLJ36751/MGC149823/MGC71889
ADAM33
Yes
Videos
SDS
Documents
Certificates