missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ADCK4 Partial ORF (AAH13114, 445 a.a. - 544 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00079934-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16180127

  • 5030.41 SEK / 25µg

Estimated Shipment: 23-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: LGEPFATQGPYDFGSGETARRIQDLIPVLLRHRLCPPPEETYALHRKLAGAFLACAHLRAHIACRDLFQDTYHRYWASRQPDAATAGSLPTKGDSWVDPS
Specifications

Specifications

AAH13114
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LGEPFATQGPYDFGSGETARRIQDLIPVLLRHRLCPPPEETYALHRKLAGAFLACAHLRAHIACRDLFQDTYHRYWASRQPDAATAGSLPTKGDSWVDPS
RUO
ADCK4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
79934
ADCK4 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ12229
ADCK4
Yes
Videos
SDS
Documents
Certificates