missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ADCYAP1R1 Partial ORF (NP_001109, 21 a.a. - 120 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000117-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16184374

  • 5030.41 SEK / 25µg

Estimated Shipment: 12-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Alternative splicing of two exons of this gene generates four major splice variants, but their full-length nature has not been determined. [provided by RefSeq]

Sequence: MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE
Specifications

Specifications

NP_001109
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE
RUO
ADCYAP1R1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
117
ADCYAP1R1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PAC1/PACAPR/PACAPRI
ADCYAP1R1
Yes
Videos
SDS
Documents
Certificates