missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ADH5 Partial ORF (NP_000662, 82 a.a. - 165 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000128-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16184394

  • 3343.96 SEK / 10µg

Estimated Shipment: 11-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene. [provided by RefSeq]

Sequence: KLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAP
Specifications

Specifications

NP_000662
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.98kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAP
RUO
ADH5
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
128
ADH5 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ADH-3/ADHX/FDH/GSNOR
ADH5
Yes
Videos
SDS
Documents
Certificates