missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AGPAT3 Full-length ORF (AAH04219.1, 1 a.a. - 63 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00056894-P02.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16122303

  • 6150.00 SEK / 25µg
Estimated Shipment: 27-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is an acyltransferase that converts lysophosphatidic acid into phosphatidic acid, which is the second step in the de novo phospholipid biosynthetic pathway. The encoded protein may be an integral membrane protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Sequence: MGSPAHLPKDAIAVFIVFPRVRHWLSGTRRQCTRRAPYVRCFKVPVLRKRSLVEEMSAEQITK
Specifications

Specifications

AAH04219.1
Liquid
56894
AGPAT3 (Human) Recombinant Protein (P02)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LPAAT-GAMMA1/MGC4604
AGPAT3
Yes
wheat germ expression system
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.7kDa
Glutathione Sepharose 4 Fast Flow
25 ug
RUO
AGPAT3
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers