missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AK3L1 Full-length ORF (NP_001002921.1, 1 a.a. - 223 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000205-P02.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16131421

  • 5030.41 SEK / 25µg

Estimated Shipment: 15-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1. [provided by RefSeq]

Sequence: MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
Specifications

Specifications

NP_001002921.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
51.7kDa
Glutathione Sepharose 4 Fast Flow
25 ug
RUO
AK3L1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
205
AK3L1 (Human) Recombinant Protein (P02)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AK3/AK4/MGC166959
AK3L1
Yes
Videos
SDS
Documents
Certificates