missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ALK Partial ORF (NP_004295, 251 a.a. - 350 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

4055.00 SEK - 6150.00 SEK

Specifications

Name ALK (Human) Recombinant Protein (Q01)
Recombinant Yes
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molecular Weight 36.74kDa
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16043615
View Documents Promotion Details
Abnova™
H00000238-Q01.25UG
25 ug
6150.00 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 08-09-2022
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16033615
View Documents Promotion Details
Abnova™
H00000238-Q01.10UG
10 ug
4055.00 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 08-09-2022
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

The 2;5 chromosomal translocation is frequently associated with anaplastic large cell lymphomas (ALCLs). The translocation creates a fusion gene consisting of the ALK (anaplastic lymphoma kinase) gene and the nucleophosmin (NPM) gene: the 3' half of ALK, derived from chromosome 2, is fused to the 5' portion of NPM from chromosome 5. A recent study shows that the product of the NPM-ALK fusion gene is oncogenic. The deduced amino acid sequences reveal that ALK is a novel receptor protein-tyrosine kinase having a putative transmembrane domain and an extracellular domain. These sequences are absent in the product of the transforming NPM-ALK gene. ALK shows the greatest sequence similarity to LTK (leukocyte tyrosine kinase). ALK plays an important role in the development of the brain and exerts its effects on specific neurons in the nervous system. [provided by RefSeq]

Sequence: DSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVS
Specifications

Specifications

ALK (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.74kDa
SDS
Product Certifications