missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AOAH Partial ORF (NP_001628, 478 a.a. - 575 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000313-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16114704

  • 4055.00 SEK / 10µg
Estimated Shipment: 22-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Acyloxyacyl hydrolase (AOAH) is a 2-subunit lipase which selectively hydrolyzes the secondary (acyloxyacyl-linked) fatty acyl chains from the lipid A region of bacterial endotoxins. AOAH may modulate host inflammatory responses to gram-negative bacterial invasion. The 2 subunits are encoded by a single mRNA. [provided by RefSeq]

Sequence: EQLSNTLKKIAASEKFTNFNLFYMDFAFHEIIQEWQKRGGQPWQLIEPVDGFHPNEVALLLLADHFWKKVQLQWPQILGKENPFNPQIKQVFGDQGGH
Specifications

Specifications

NP_001628
Liquid
313
AOAH (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AOAH
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
EQLSNTLKKIAASEKFTNFNLFYMDFAFHEIIQEWQKRGGQPWQLIEPVDGFHPNEVALLLLADHFWKKVQLQWPQILGKENPFNPQIKQVFGDQGGH
RUO
AOAH
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers