Läs mer
Abnova™ Human APPL Partial ORF (NP_036228, 611 a.a. - 708 a.a.) Recombinant Protein with GST-tag at N-terminal
Beskrivning
The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A, DCC, AKT2, PIK3CA, adiponectin receptors, and proteins of the NuRD/MeCP1 complex. This protein is found associated with endosomal membranes, but can be released by EGF and translocated to the nucleus. [provided by RefSeq]
Specifikationer
Specifikationer
Tillträdesnummer | NP_036228 |
För användning med (applikation) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulering | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 26060 |
Molekylvikt (g/mol) | 36.52kDa |
Namn | APPL (Human) Recombinant Protein (Q01) |
Kvalitetskontrolltestning | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Kvantitet | 10 μg |
Immunogen | EGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRESE |
Förvaringskrav | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Visa mer |
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.