missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ARHGEF9 Partial ORF (NP_056000.1, 419 a.a. - 516 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00023229-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16134516

  • 6150.00 SEK / 25µg
Estimated Shipment: 08-09-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ARHGEF9 belongs to a family of Rho-like GTPases that act as molecular switches by cycling from the active GTP-bound state to the inactive GDP-bound state. These proteins are key regulators of the actin cytoskeleton and are involved in cell signaling.[supplied by OMIM]

Sequence: AFREERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Specifications

Specifications

NP_056000.1
Liquid
23229
ARHGEF9 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
COLLYBISTIN/HPEM-2/KIAA0424/PEM-2/PEM2
ARHGEF9
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AFREERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
RUO
ARHGEF9
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers