missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ATG3 Full-length ORF (NP_071933.2, 1 a.a. - 314 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00064422-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16133613

  • 5030.41 SEK / 25µg

Estimated Shipment: 11-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Autophagy is a process of bulk degradation of cytoplasmic components by the lysosome or vacuole. Human ATG3 displays the same enzymatic characteristics in vitro as yeast Apg3, a protein-conjugating enzyme essential for autophagy (Tanida et al., 2002 [PubMed 11825910]).[supplied by OMIM]

Sequence: MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM
Specifications

Specifications

NP_071933.2
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
62.3kDa
Glutathione Sepharose 4 Fast Flow
25 ug
RUO
ATG3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
64422
ATG3 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
APG3/APG3-LIKE/APG3L/DKFZp564M1178/FLJ22125/MGC15201/PC3-96
ATG3
Yes
Videos
SDS
Documents
Certificates