missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ATP5J Full-length ORF (AAH01178, 1 a.a. - 108 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000522-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16182061

  • 3343.96 SEK / 10µg

Estimated Shipment: 17-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The F0 seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the F6 subunit of the F0 complex, required for F1 and F0 interactions. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq]

Sequence: MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA
Specifications

Specifications

AAH01178
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.62kDa
Glutathione Sepharose 4 Fast Flow
10 ug
RUO
ATP5J
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
522
ATP5J (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ATP5/ATP5A/ATPM/CF6/F6
ATP5J
Yes
Videos
SDS
Documents
Certificates