missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30194044

Invitrogen™ Human ATP5S Control Fragment Recombinant Protein

Produktkod. 30194044
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30194044 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30194044 Leverantör Invitrogen™ Leverantörsnummer RP100133

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61384 (PA5-61384. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP5S, also known as ATP synthase subunits, mitochondrial, ATP synthase-coupling factor B or ATP synthase, H+ transporting, mitochondrial F0 complex, subunits (factor B), is a 215 amino acid mitochondrial inner membrane protein that belongs to the ATP synthase subunits family. Involved in regulation of mitochondrial membrane ATP synthase, ATP5S is necessary for H+ conduction of ATP synthase. The ATP5S gene encodes subunits, also known as factor B, of the proton channel. This subunit is necessary for energy transduction in ATP synthase complexes. The ATP5S gene is conserved in chimpanzee, canine, bovine, mouse, rat, chicken, zebrafish and mosquito, and maps to human chromosome 14q21.3.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q99766
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 27109
Namn Human ATP5S Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias 1110015E18Rik; ATP synthase coupling factor B, mitochondrial; ATP synthase coupling factor B-like 1; ATP synthase subunit s, mitochondrial; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit S; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit s (factor B); ATP synthase, H+ transporting, mitochondrial Fo complex subunit s (factor B); ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B); ATP synthase-coupling factor B; ATP5S; Atpw; Distal membrane arm assembly complex 2-like protein; DMAC2L; Factor B; facyor B; FB; HSU79253; Mitochondrial ATP synthase regulatory component factor B
Vanligt namn ATP5S
Gensymbol DMAC2L
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens MCCAVSEQRLTCADQMMLFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRC
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.