missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human ATP6V0A1 (aa 35-129) Control Fragment Recombinant Protein

Produktkod. 30194617
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30194617

Brand: Invitrogen™ RP93230

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54570 (PA5-54570. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP6V0A1 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three A subunit proteins and the encoded protein is associated with clathrin-coated vesicles.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q93050
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 535
Namn Human ATP6V0A1 (aa 35-129) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias a1; AA959968; adenosine triphosphatase; ATP6a1; ATP6N1; ATP6N1A; Atp6v0a1; ATPase H+ transporting lysosomal (vacuolar proton pump) noncatalytic accessory protein 1 (110/160 kDa); ATPase H+ transporting V0 subunit a1; ATPase, H+ transporting, lysosomal (vacuolar proton pump) noncatalytic accessory protein 1 (110/160 kDa); ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 1 A (110/116 kD); ATPase, H+ transporting, lysosomal (vacuolar proton pump) noncatalytic accessory protein 1 A (110/160 kDa); ATPase, H+ transporting, lysosomal non-catalytic accessory protein 1 (110/116 kD); ATPase, H+ transporting, lysosomal noncatalytic accessory protein 1 A; ATPase, H+ transporting, lysosomal V0 subunit a; ATPase, H+ transporting, lysosomal V0 subunit a1; Atpv0a1; Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit; H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1; Stv1; V-A; vacuolar adenosine triphosphatase subunit Ac116; vacuolar H+-ATPase subunit; vacuolar proton pump subunit 1; vacuolar proton translocating ATPase 116 kDa subunit A; Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1; vacuolar proton-translocating ATPase a1 isoform; vacuolar-type H(+)-ATPase 115 kDa subunit; V-ATPase 116 kDa; V-ATPase 116 kDa isoform a1; V-ATPase 116 kDa subunit; V-ATPase 116 kDa subunit a1; V-ATPase a1; v-H+ATPase subunit a1; Vph1; Vpp1; Vpp-1; V-type proton ATPase 116 kDa subunit a; V-type proton ATPase 116 kDa subunit a isoform 1; V-type proton ATPase 116 kDa subunit a isoform 1; V-type proton ATPase 116 kDa subunit a; V-type proton ATPase 116 kDa subunit a1
Vanligt namn ATP6V0A1
Gensymbol ATP6V0A1
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens VQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELK
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.