missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human ATP6V0A4 (aa 111-170) Control Fragment Recombinant Protein

Produktkod. 30211417
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30211417

Brand: Invitrogen™ RP103564

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84650 (PA5-84650. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', and d. This gene is one of four genes in man and mouse that encode different isoforms of the a subunit. Alternatively spliced transcript variants encoding the same protein have been described. Mutations in this gene are associated with renal tubular acidosis associated with preserved hearing. [provided by RefSeq, Jul 2008]
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q9HBG4
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 50617
Namn Human ATP6V0A4 (aa 111-170) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias a4; Atp6n1b; ATP6N2; Atp6v0a4; ATPase H+ transporting V0 subunit a4; ATPase, H+ transporting, lysosomal (vacuolar proton pump) noncatalytic accessory protein 1 B; ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 1 B; ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 2 (38 kD); ATPase, H+ transporting, lysosomal V0 subunit A4; H(+)-transporting two-sector ATPase, noncatalytic accessory protein 1 B; RDRTA2; RTA1C; RTADR; STV1; tcag7.346; vacuol; vacuolar proton pump 116 kDa accessory subunit; vacuolar proton pump, subunit 2; vacuolar proton translocating ATPase 100 kDa a4 subunit; Vacuolar proton translocating ATPase 116 kDa subunit a isoform 4; Vacuolar proton translocating ATPase 116 kDa subunit a kidney isoform; V-ATPase 116 kDa; V-ATPase 116 kDa isoform a4; V-ATPase alpha 4; VPH1; VPP2; V-type proton ATPase 116 kDa subunit a; V-type proton ATPase 116 kDa subunit a isoform 4
Vanligt namn ATP6V0A4
Gensymbol ATP6V0A4
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens NQNQQALKQSFLELTELKYLLKKTQDFFETETNLADDFFTEDTSGLLELKAVPAYMTGKL
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.