missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ATP6V1F Full-length ORF (NP_004222.2, 1 a.a. - 119 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009296-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16133502

  • 5030.41 SEK / 25µg

Estimated Shipment: 17-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c”, and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is the V1 domain F subunit protein. [provided by RefSeq]

Sequence: MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR
Specifications

Specifications

NP_004222.2
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
39.8kDa
Glutathione Sepharose 4 Fast Flow
25 ug
RUO
ATP6V1F
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9296
ATP6V1F (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ATP6S14/MGC117321/MGC126037/MGC126038/VATF/Vma7
ATP6V1F
Yes
Videos
SDS
Documents
Certificates