missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ATP8B1 Partial ORF (NP_005594.1, 471 a.a. - 551 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005205-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16182645

  • 5030.41 SEK / 25µg

Estimated Shipment: 15-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of the P-type cation transport ATPase family, which belongs to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Mutations in this gene may result in progressive familial intrahepatic cholestasis type 1 and in benign recurrent intrahepatic cholestasis. [provided by RefSeq]

Sequence: INGQIYGDHRDASQHNHNKIEQVDFSWNTYADGKLAFYDHYLIEQIQSGKEPEVRQFFFLLAVCHTVMVDRTDGQLNYQAA
Specifications

Specifications

NP_005594.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.65kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
INGQIYGDHRDASQHNHNKIEQVDFSWNTYADGKLAFYDHYLIEQIQSGKEPEVRQFFFLLAVCHTVMVDRTDGQLNYQAA
RUO
ATP8B1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5205
ATP8B1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ATPIC/BRIC/FIC1/PFIC/PFIC1
ATP8B1
Yes
Videos
SDS
Documents
Certificates