missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ATXN3 Full-length ORF (NP_001019802.1, 1 a.a. - 79 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004287-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16120188

  • 6150.00 SEK / 25µg
Estimated Shipment: 16-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by this gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq]

Sequence: MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQK
Specifications

Specifications

NP_001019802.1
Liquid
4287
ATXN3 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AT3/ATX3/JOS/MJD/MJD1/SCA3
ATXN3
Yes
wheat germ expression system
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.4kDa
Glutathione Sepharose 4 Fast Flow
25 ug
RUO
ATXN3
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers