missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BATF Full-length ORF (NP_006390.1, 1 a.a. - 125 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

3970.00 SEK - 6025.00 SEK

Specifications

Accession Number NP_006390.1
For Use With (Application) Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Format Liquid
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 10538
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16135272
View Documents Promotion Details
Abnova™
H00010538-P01.25UG
25 ug
6025.00 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 13-01-2023
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16125272
View Documents Promotion Details
Abnova™
H00010538-P01.10UG
10 ug
3970.00 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 13-01-2023
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. [provided by RefSeq]

Sequence: MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
Specifications

Specifications

NP_006390.1
Liquid
10538
BATF (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
RUO
BATF
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
40.5kDa
Glutathione Sepharose 4 Fast Flow
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
B-ATF/BATF1/SFA-2/SFA2
BATF
Yes
wheat germ expression system
SDS
Product Certifications