missing translation for 'onlineSavingsMsg'
Läs mer
Invitrogen™ Human BCAM (aa 312-445) Control Fragment Recombinant Protein Produktkod.: 30210250
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30210250

Invitrogen™ Human BCAM (aa 312-445) Control Fragment Recombinant Protein

Produktkod. 30210250
100 μL
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30210250

Brand: Invitrogen™ RP100994

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52175 (PA5-52175. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lutheran blood group glycoprotein is a member of the immunoglobulin superfamily and a receptor for the extracellular matrix protein, laminin. The protein contains five, N-terminus, extracellular immunoglobulin domains, a single transmembrane domain, and a short, C-terminal cytoplasmic tail. This protein may play a role in epithelial cell cancer and in vaso-occlusion of red blood cells in sickle cell disease. Two transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer P50895
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 4059
Namn Human BCAM (aa 312-445) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias 1200005K12Rik; antigen identified by monoclonal antibody F8; AU; Auberger B antigen; basal cell adhesion molecule; basal cell adhesion molecule (Lu and Au blood groups); basal cell adhesion molecule (Lutheran blood group); basal cell adhesion molecule Lutheran blood group; BCAM; B-CAM; B-CAM cell surface glycoprotein; B-cell adhesion molecule; CD239; F8/G253 antigen; glycoprotein 95 kDa; Gplu; LU; lutheran antigen; Lutheran blood group; Lutheran blood group (Auberger b antigen included); Lutheran blood group glycoprotein; Lutheran blood group variant LUGA; lutheran glycoprotein; MSK19
Vanligt namn BCAM
Gensymbol BCAM
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens EVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQ
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel
Invitrogen™ Human BCAM (aa 312-445) Control Fragment Recombinant Protein >

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.