missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BCL7A Partial ORF (NP_066273.1, 1 a.a. - 54 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000605-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16135184

  • 5030.41 SEK / 25µg

Estimated Shipment: 03-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEP
Specifications

Specifications

NP_066273.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.68kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEP
RUO
BCL7A
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
605
BCL7A (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BCL7
BCL7A
Yes
Videos
SDS
Documents
Certificates