missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BCMO1 Partial ORF (NP_059125.2, 254 a.a. - 353 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00053630-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16177416

  • 5030.41 SEK / 25µg

Estimated Shipment: 02-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules. [provided by RefSeq]

Sequence: RLDILKMATAYIRRMSWASCLAFHREEKTYIHIIDQRTRQPVQTKFYTGAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRLTSV
Specifications

Specifications

NP_059125.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RLDILKMATAYIRRMSWASCLAFHREEKTYIHIIDQRTRQPVQTKFYTGAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRLTSV
RUO
BCMO1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
53630
BCMO1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BCDO/BCDO1/BCMO/BCO/BCO1/FLJ10730
BCMO1
Yes
Videos
SDS
Documents
Certificates