missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human BMP8A Partial ORF (NP_861525.1, 112 a.a. - 208 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00353500-Q01.10ug
Additional Details : Weight : 0.02000kg
Description
Sequence: VERDRALGHQEPHWKEFRFDLTQIPAGEAVTAAEFRIYKVPSIHLLNRTLHVSMFQVVQEQSNRESDLFFLDLQTLRAGDEGWLVLDVTAASDCWLLSpecifications
| NP_861525.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.41kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| VERDRALGHQEPHWKEFRFDLTQIPAGEAVTAAEFRIYKVPSIHLLNRTLHVSMFQVVQEQSNRESDLFFLDLQTLRAGDEGWLVLDVTAASDCWLL | |
| RUO | |
| BMP8A | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 353500 | |
| BMP8A (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ14351/FLJ45264 | |
| BMP8A | |
| Recombinant | |
| wheat germ expression system |